AagingBase | Database of anti-aging peptide

AagingBase: Database of anti-aging peptides A manually curated comprehensive database for anti-aging peptides

Peptide Card for AAPeptide280

The Peptide Card page for AAPeptide280 gives textual and graphical visualizations of the properties of AAPeptide280. The users can find all the literature informations collected from scholarly articles and patents and the calculated physicochemical informations. There are also graphical representations hydropathy values, amino acid compositions and frequencies, atomic compositions and secondary structure fractions of AAPeptide280.
To obtain further details, refer to the Help page.

AAP ID	AAPeptide280
Peptide name	Klotho-derived peptide 6
PubMed/Patent ID	35644285
Origin	Natural
Source of Origin	Human
Condition addressed	Diabetic kidney disease (DKD) , (STZ-induced type 1 and genetic db/db type 2 diabetes)
Experiment type	In vitro, In vivo
Cell lines/Animal model	The mouse podocytes(HKC-8), Human proximal tubular cells (HK-2), Male CD-1 mice
Intervention	Cells were treated with the peptide, Mice were withnthe vehicle containing peptide using osmotic pumps
Experiment methods	Histopathology, Immunohistochemical staining, Western Blot, ELISA (Urinary albumin&creatinine assay), Co-immunoprecipitation, Dual luciferase reporter assay
Patient group	NA
Markers used	Renal podocalyxin, nephrin, ZO-1 and desmin
Mechanism of action	Mitigates glomerular injury, Alleviates podocyte damage, Reverses albuminuria, Prevents glomerulosclerosis and interstitial fibrosis

Molecular weight	3491.825
Peptide length	30
Instability index	50.513
Aromaticity	0.133
Aliphaticity	0.467
Reduced molecular extinction coeffecient	13980
Oxidized molecular extinction coeffecient	13980
Isoelectric point	5.987
Composition of positively charged residues	0.133
Composition of negatively charged residues	0.100
Composition of neutral charged residues	0.767
Composition of residues polar residues	0.200
Composition of residues non-polar residues	0.533
Composition of residues having cyclic side chain	0.067
Composition of acidic residues	0.100
Composition of basic residues	0.133
Composition of residues having cyclic side chain	0.067
Composition of hydroxylic residues	0.033
Composition of residue in buried solvent accessibility	0.467
Composition of residue in exposed solvent accessibility	0.300
Composition of residue in intermediate solvent accessibility	0.233

AAPeptide280 :

QPVVTLYHWDLPQRLQDAYGGWANRALADH

Amino acid data

ProtScale

Atomic information

3D Structure

Structural Representation of AAPeptide280

Amino acid data

Secondary structure fraction