AagingBase | Database of anti-aging peptide

AagingBase: Database of anti-aging peptides A manually curated comprehensive database for anti-aging peptides

Peptide Card for AAPeptide270

The Peptide Card page for AAPeptide270 gives textual and graphical visualizations of the properties of AAPeptide270. The users can find all the literature informations collected from scholarly articles and patents and the calculated physicochemical informations. There are also graphical representations hydropathy values, amino acid compositions and frequencies, atomic compositions and secondary structure fractions of AAPeptide270.
To obtain further details, refer to the Help page.

AAP ID	AAPeptide270
Peptide name	Klotho-derived peptide 1
PubMed/Patent ID	35064106
Origin	Natural
Source of Origin	Human
Condition addressed	Chronic kidney disease
Experiment type	In vitro, In vivo
Cell lines/Animal model	Normal rat kidney interstitial fibroblast (NRK-49F), Primary kidney tubular epithelial cells, Human proximal tubular cells (HKC-8), Rat primary cardiomyocytes, Rat primary cardiac fibroblasts, BALB/c mice
Intervention	Cells were treated with the peptide, Intravenous administration of the peptide
Experiment methods	qRT-PCR, Western blot, Co-immunoprecipitation, Affinity measurements by Biacore T200, KP1 and TβR2 direct binding assay, Organ imaging of KP1 distribution, Histology and immunostaining
Patient group	NA
Markers used	NA
Mechanism of action	Restores Klotho expression by blocking H3K9 hypermethylation by inhibition of TGF-beta signalling, Binds to TβR2, Disrupts TGF-β and TβR2 engagement, and blocks Smad and MAPK signaling

Molecular weight	3228.441
Peptide length	30
Instability index	26.860
Aromaticity	0.200
Aliphaticity	0.433
Reduced molecular extinction coeffecient	12490
Oxidized molecular extinction coeffecient	12490
Isoelectric point	5.321
Composition of positively charged residues	0.067
Composition of negatively charged residues	0.067
Composition of neutral charged residues	0.867
Composition of residues polar residues	0.267
Composition of residues non-polar residues	0.600
Composition of residues having cyclic side chain	0.033
Composition of acidic residues	0.067
Composition of basic residues	0.067
Composition of residues having cyclic side chain	0.033
Composition of hydroxylic residues	0.100
Composition of residue in buried solvent accessibility	0.567
Composition of residue in exposed solvent accessibility	0.267
Composition of residue in intermediate solvent accessibility	0.200

AAPeptide270 :

FQGTFPDGFLWAVGSAAYQTEGGWQQHGKG

Amino acid data

ProtScale

Atomic information

3D Structure

Structural Representation of AAPeptide270

Amino acid data

Secondary structure fraction