AagingBase | Database of anti-aging peptide

AagingBase: Database of anti-aging peptides A manually curated comprehensive database for anti-aging peptides

Peptide Card for AAPeptide266

The Peptide Card page for AAPeptide266 gives textual and graphical visualizations of the properties of AAPeptide266. The users can find all the literature informations collected from scholarly articles and patents and the calculated physicochemical informations. There are also graphical representations hydropathy values, amino acid compositions and frequencies, atomic compositions and secondary structure fractions of AAPeptide266.
To obtain further details, refer to the Help page.

AAP ID	AAPeptide266
Peptide name	SOCS3 reduction peptide (SRP)
PubMed/Patent ID	US 10906949 B2
Origin	NA
Source of Origin	NA
Condition addressed	Nervous system injuries (spinal cord injury (SCI)) caused by trauma or neurodegeneration or aging
Experiment type	In vivo
Cell lines/Animal model	Rat model
Intervention	Peptide has been applied on the rat after spinal cord injury
Experiment methods	Immunolabeling, BBB open field locomotion test
Patient group	NA
Markers used	LAMP1 (lysosomal marker)
Mechanism of action	Increases TBK1 and mitophagy adaptors in the spinal cord after SCI

Molecular weight	4524.163
Peptide length	35
Instability index	85.286
Aromaticity	0.143
Aliphaticity	0.200
Reduced molecular extinction coeffecient	2980
Oxidized molecular extinction coeffecient	2980
Isoelectric point	11.568
Composition of positively charged residues	0.371
Composition of negatively charged residues	0.086
Composition of neutral charged residues	0.543
Composition of residues polar residues	0.257
Composition of residues non-polar residues	0.286
Composition of residues having cyclic side chain	0.029
Composition of acidic residues	0.086
Composition of basic residues	0.371
Composition of residues having cyclic side chain	0.029
Composition of hydroxylic residues	0.086
Composition of residue in buried solvent accessibility	0.257
Composition of residue in exposed solvent accessibility	0.343
Composition of residue in intermediate solvent accessibility	0.200

AAPeptide266 :

YGRKKRRQRRRVQPYSTVVHSKFERQKILDQRFFE

Amino acid data

ProtScale

Atomic information

3D Structure

Structural Representation of AAPeptide266

Amino acid data

Secondary structure fraction