AagingBase | Database of anti-aging peptide

AagingBase: Database of anti-aging peptides A manually curated comprehensive database for anti-aging peptides

Peptide Card for AAPeptide242

The Peptide Card page for AAPeptide242 gives textual and graphical visualizations of the properties of AAPeptide242. The users can find all the literature informations collected from scholarly articles and patents and the calculated physicochemical informations. There are also graphical representations hydropathy values, amino acid compositions and frequencies, atomic compositions and secondary structure fractions of AAPeptide242.
To obtain further details, refer to the Help page.

AAP ID	AAPeptide242
Peptide name	Chondroitin sulfate proteoglycan (CSPG) reduction peptide (CRP)
PubMed/Patent ID	US 10906949 B2
Origin	NA
Source of Origin	NA
Condition addressed	Nervous system injuries (spinal cord injury (SCI)) caused by trauma or neurodegeneration or aging
Experiment type	In vitro, In vivo
Cell lines/Animal model	Neu7 astrocytes, Rat model
Intervention	Cells were treated with the peptide, Peptide has been applied on the rat after spinal cord injury
Experiment methods	Immunolabeling, Kinematics assessment in rats
Patient group	NA
Markers used	LAMP1 (lysosomal marker)
Mechanism of action	Improves locomotion and bladder electromyography (EMG) activities, Increases sprouting/regeneration of axons including serotonin (5-HT) and anterogradely traced fibers from brain stem and red nuclei, the critical pathways regulating both locomotion and bladder functions, Could be applied to limb transplants, Improves motor function and bladder functions, Treats neurodegenerative disorders such as MS and related conditions

Molecular weight	5923.876
Peptide length	46
Instability index	71.657
Aromaticity	0.130
Aliphaticity	0.174
Reduced molecular extinction coeffecient	6990
Oxidized molecular extinction coeffecient	6990
Isoelectric point	11.849
Composition of positively charged residues	0.413
Composition of negatively charged residues	0.065
Composition of neutral charged residues	0.522
Composition of residues polar residues	0.174
Composition of residues non-polar residues	0.283
Composition of residues having cyclic side chain	0.043
Composition of acidic residues	0.065
Composition of basic residues	0.413
Composition of residues having cyclic side chain	0.043
Composition of hydroxylic residues	0.043
Composition of residue in buried solvent accessibility	0.261
Composition of residue in exposed solvent accessibility	0.457
Composition of residue in intermediate solvent accessibility	0.109

AAPeptide242 :

NYGRKKRRQRRRPKPRVTWNKKGKKVNSQRFKFERQKILDQRFFEC

Amino acid data

ProtScale

Atomic information

3D Structure

Structural Representation of AAPeptide242

Amino acid data

Secondary structure fraction