AagingBase | Database of anti-aging peptide

AagingBase: Database of anti-aging peptides A manually curated comprehensive database for anti-aging peptides

Peptide Card for AAPeptide192

The Peptide Card page for AAPeptide192 gives textual and graphical visualizations of the properties of AAPeptide192. The users can find all the literature informations collected from scholarly articles and patents and the calculated physicochemical informations. There are also graphical representations hydropathy values, amino acid compositions and frequencies, atomic compositions and secondary structure fractions of AAPeptide192.
To obtain further details, refer to the Help page.

AAP ID	AAPeptide192
Peptide name	Intermedin
PubMed/Patent ID	32229709
Origin	Natural
Source of Origin	Human
Condition addressed	Vascular calcification
Experiment type	In vitro
Cell lines/Animal model	Rat vascular smooth muscle cells (VSMCs), Human VSMC CRL1999 cells, Sprague-Dawley (SD) rats
Intervention	Administartion of the peptide in vitamin D3 plus nicotine (VDN) treated old rats.
Experiment methods	ALP activity assay, SA-β-gal staining, Immunostaining, qRT-PCR, Western blot
Patient group	NA
Markers used	NA
Mechanism of action	Has a protective role in aging-associated vascular calcification

Molecular weight	5103.732
Peptide length	47
Instability index	47.828
Aromaticity	0.043
Aliphaticity	0.447
Reduced molecular extinction coeffecient	6990
Oxidized molecular extinction coeffecient	7115
Isoelectric point	7.800
Composition of positively charged residues	0.106
Composition of negatively charged residues	0.043
Composition of neutral charged residues	0.851
Composition of residues polar residues	0.340
Composition of residues non-polar residues	0.489
Composition of residues having cyclic side chain	0.085
Composition of acidic residues	0.043
Composition of basic residues	0.106
Composition of residues having cyclic side chain	0.085
Composition of hydroxylic residues	0.149
Composition of residue in buried solvent accessibility	0.426
Composition of residue in exposed solvent accessibility	0.277
Composition of residue in intermediate solvent accessibility	0.319

AAPeptide192 :

TQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSY

Amino acid data

ProtScale

Atomic information

3D Structure

Structural Representation of AAPeptide192

Amino acid data

Secondary structure fraction