AagingBase | Database of anti-aging peptide

Peptide Card for AAPeptide191

The Peptide Card page for AAPeptide191 gives textual and graphical visualizations of the properties of AAPeptide191. The users can find all the literature informations collected from scholarly articles and patents and the calculated physicochemical informations. There are also graphical representations hydropathy values, amino acid compositions and frequencies, atomic compositions and secondary structure fractions of AAPeptide191.
To obtain further details, refer to the Help page.

AAP IDAAPeptide191
Peptide nameRGD motif-containing peptide or a fragment
PubMed/Patent IDUS 10632181 B2,US 2020/0000891 A1
OriginNatural
Source of OriginHuman
Condition addressedSkin aging
Experiment typeIn vivo, Randomized clinical trial
Cell lines/Animal modelSD (Sprague-Dawley) rats
InterventionTest subsatance were applied to the skin of the burned male SD rats repeatedly once a day seven times a week for 7 days., Topical application of the products on each of left and right sides of the face twice daily
Experiment methodsAssessment of Wrinkle Reduction Effect, Glaucoma Test Effect
Patient groupWomen aged 30-66,Women aged 30-65
Markers usedNA
Mechanism of actionEffectively treat burns and glaucoma, obtain an excellent effect of alleviating skin wrinkles, and is effective in the promotion of hair restoration and hair growth as well as the prevention of hair loss
Molecular weight6114.736
Peptide length58
Instability index47.617
Aromaticity0.034
Aliphaticity0.379
Reduced molecular extinction coeffecient5500
Oxidized molecular extinction coeffecient6000
Isoelectric point4.274
Composition of positively charged residues0.069
Composition of negatively charged residues0.121
Composition of neutral charged residues0.810
Composition of residues polar residues0.379
Composition of residues non-polar residues0.414
Composition of residues having cyclic side chain0.138
Composition of acidic residues0.121
Composition of basic residues0.069
Composition of residues having cyclic side chain0.138
Composition of hydroxylic residues0.121
Composition of residue in buried solvent accessibility0.431
Composition of residue in exposed solvent accessibility0.379
Composition of residue in intermediate solvent accessibility0.259

AAPeptide191 :
TCQLRPGAQCASDGPCCQNCQLRPSGWQCRPTRGDCDLPEFCPGDSSQCPPDVSLGDG

Amino acid data
ProtScale
Atomic information


3D Structure

Structural Representation of AAPeptide191

Amino acid data
Secondary structure fraction