AagingBase | Database of anti-aging peptide

AagingBase: Database of anti-aging peptides A manually curated comprehensive database for anti-aging peptides

Peptide Card for AAPeptide153

The Peptide Card page for AAPeptide153 gives textual and graphical visualizations of the properties of AAPeptide153. The users can find all the literature informations collected from scholarly articles and patents and the calculated physicochemical informations. There are also graphical representations hydropathy values, amino acid compositions and frequencies, atomic compositions and secondary structure fractions of AAPeptide153.
To obtain further details, refer to the Help page.

AAP ID	AAPeptide153
Peptide name	Ginsentide TP1
PubMed/Patent ID	US 2020/0277343 A1,US 11174298 B2
Origin	Natural
Source of Origin	Panax ginseng
Condition addressed	Skin aging
Experiment type	In vitro
Cell lines/Animal model	Human umbilical vein endothelial cells (HUVEC)
Intervention	Cells were treated with the peptide
Experiment methods	Mass spectrometry, Protein quantification
Patient group	NA
Markers used	NA
Mechanism of action	Reduces apoptosis signaling pathways and reduced cell adhesion pathways, Promotes adaptation of endothelials cells to hypoxic stress, Reduces unfolded proteins in cardiomyocyte, vascular smooth muscle cells, and myocytes, Reduces reactive oxygen species production in hypoxic endothelial cells, Prevents telomere shortening, Prevents oxidative stress induced aging

Molecular weight	3063.515
Peptide length	31
Instability index	3.145
Aromaticity	0.129
Aliphaticity	0.419
Reduced molecular extinction coeffecient	6990
Oxidized molecular extinction coeffecient	7490
Isoelectric point	6.678
Composition of positively charged residues	0.065
Composition of negatively charged residues	0.032
Composition of neutral charged residues	0.903
Composition of residues polar residues	0.355
Composition of residues non-polar residues	0.516
Composition of residues having cyclic side chain	0.032
Composition of acidic residues	0.032
Composition of basic residues	0.065
Composition of residues having cyclic side chain	0.032
Composition of hydroxylic residues	0.065
Composition of residue in buried solvent accessibility	0.742
Composition of residue in exposed solvent accessibility	0.129
Composition of residue in intermediate solvent accessibility	0.161

AAPeptide153 :

CKSGGAWCGFDPHGCCGNCGCLVGFCYGTGC

Amino acid data

ProtScale

Atomic information

3D Structure

Structural Representation of AAPeptide153

Amino acid data

Secondary structure fraction