AagingBase | Database of anti-aging peptide

AagingBase: Database of anti-aging peptides A manually curated comprehensive database for anti-aging peptides

Peptide Card for AAPeptide117

The Peptide Card page for AAPeptide117 gives textual and graphical visualizations of the properties of AAPeptide117. The users can find all the literature informations collected from scholarly articles and patents and the calculated physicochemical informations. There are also graphical representations hydropathy values, amino acid compositions and frequencies, atomic compositions and secondary structure fractions of AAPeptide117.
To obtain further details, refer to the Help page.

AAP ID	AAPeptide117
Peptide name	LCE6A
PubMed/Patent ID	US 11479580 B2,US 2019/0010191 A1
Origin	Natural
Source of Origin	Human
Condition addressed	Skin aging
Experiment type	In vitro, Ex vivo
Cell lines/Animal model	Psoriatic Human Epidermis, Human abdominal skin
Intervention	Cells were treated with the peptides,Cells were treated with the peptide
Experiment methods	Immunohistochemistry, Western blot, In-Vitro Transglutaminase 2 Binding Assay (TGM2), In-Vitro Transglutaminase 3 Binding Assay (TGM3), In situ binding assay
Patient group	15 subjects with psoriasis
Markers used	NA
Mechanism of action	Reinforces the barrier function of the epidermis, Treats the signs of skin dryness and prevent and/or treat disorders of the barrier function or the weakening of the epidermis

Molecular weight	9022.055
Peptide length	80
Instability index	99.818
Aromaticity	0.038
Aliphaticity	0.288
Reduced molecular extinction coeffecient	8480
Oxidized molecular extinction coeffecient	8855
Isoelectric point	9.135
Composition of positively charged residues	0.200
Composition of negatively charged residues	0.088
Composition of neutral charged residues	0.712
Composition of residues polar residues	0.375
Composition of residues non-polar residues	0.312
Composition of residues having cyclic side chain	0.138
Composition of acidic residues	0.088
Composition of basic residues	0.200
Composition of residues having cyclic side chain	0.138
Composition of hydroxylic residues	0.162
Composition of residue in buried solvent accessibility	0.250
Composition of residue in exposed solvent accessibility	0.425
Composition of residue in intermediate solvent accessibility	0.375

AAPeptide117 :

MSQQKQQSWKPPNVPKCSPPQRSNPCLAPYSTPCGAPHSEGCHSSSQRPEVQKPRRARQKLRCLSRGTTYHCKEEECEGD

Amino acid data

ProtScale

Atomic information

3D Structure

Structural Representation of AAPeptide117

Amino acid data

Secondary structure fraction