AagingBase | Database of anti-aging peptide

AagingBase: Database of anti-aging peptides A manually curated comprehensive database for anti-aging peptides

Peptide Card for AAPeptide114

The Peptide Card page for AAPeptide114 gives textual and graphical visualizations of the properties of AAPeptide114. The users can find all the literature informations collected from scholarly articles and patents and the calculated physicochemical informations. There are also graphical representations hydropathy values, amino acid compositions and frequencies, atomic compositions and secondary structure fractions of AAPeptide114.
To obtain further details, refer to the Help page.

AAP ID	AAPeptide114
Peptide name	NA
PubMed/Patent ID	US 2019/0343923 A1,US 10314888 B2
Origin	Natural
Source of Origin	Human
Condition addressed	Skin aging
Experiment type	In vitro
Cell lines/Animal model	Human Mesenchymal Stem Cells (Fibrocytes), Dog Pancreas (NAT-CRT)
Intervention	Cells were treated with the peptide
Experiment methods	In Vitro Wound Healing Assay, Western Blot
Patient group	40 female subjects aged 45-55 years old
Markers used	NA
Mechanism of action	Eliminates wrinkles and/or fine lines, Tissue repair and reconstruction, Treates wound in a patient suffering from delayed wound healing

Molecular weight	3922.567
Peptide length	32
Instability index	46.260
Aromaticity	0.094
Aliphaticity	0.312
Reduced molecular extinction coeffecient	1490
Oxidized molecular extinction coeffecient	1490
Isoelectric point	7.143
Composition of positively charged residues	0.344
Composition of negatively charged residues	0.062
Composition of neutral charged residues	0.594
Composition of residues polar residues	0.125
Composition of residues non-polar residues	0.469
Composition of residues having cyclic side chain	0.062
Composition of acidic residues	0.062
Composition of basic residues	0.344
Composition of residues having cyclic side chain	0.062
Composition of hydroxylic residues	0.094
Composition of residue in buried solvent accessibility	0.312
Composition of residue in exposed solvent accessibility	0.188
Composition of residue in intermediate solvent accessibility	0.562

AAPeptide114 :

MHHHHHHHHMKKLLFAIPLVVPFYSHSTMELE

Amino acid data

ProtScale

Atomic information

3D Structure

Structural Representation of AAPeptide114

Amino acid data

Secondary structure fraction