AagingBase | Database of anti-aging peptide

AagingBase: Database of anti-aging peptides A manually curated comprehensive database for anti-aging peptides

Peptide Card for AAPeptide016

The Peptide Card page for AAPeptide016 gives textual and graphical visualizations of the properties of AAPeptide016. The users can find all the literature informations collected from scholarly articles and patents and the calculated physicochemical informations. There are also graphical representations hydropathy values, amino acid compositions and frequencies, atomic compositions and secondary structure fractions of AAPeptide016.
To obtain further details, refer to the Help page.

AAP ID	AAPeptide016
Peptide name	hPTH(1-34)
PubMed/Patent ID	27887949
Origin	Synthetic
Source of Origin	NA
Condition addressed	Osteoporosis
Experiment type	In vivo
Cell lines/Animal model	Sprague Dawley rats
Intervention	Subcutaneous injection of the peptide
Experiment methods	Blood and serum parameter analysis, Histopathology, Bone biochemical tests, ALPase activity, Serum Ca and P level
Patient group	NA
Markers used	NA
Mechanism of action	Elevates the bone mass

Molecular weight	4549.204
Peptide length	38
Instability index	75.034
Aromaticity	0.053
Aliphaticity	0.342
Reduced molecular extinction coeffecient	5500
Oxidized molecular extinction coeffecient	5500
Isoelectric point	9.717
Composition of positively charged residues	0.237
Composition of negatively charged residues	0.105
Composition of neutral charged residues	0.658
Composition of residues polar residues	0.132
Composition of residues non-polar residues	0.447
Composition of residues having cyclic side chain	0.105
Composition of acidic residues	0.105
Composition of basic residues	0.237
Composition of residues having cyclic side chain	0.105
Composition of hydroxylic residues	0.079
Composition of residue in buried solvent accessibility	0.289
Composition of residue in exposed solvent accessibility	0.421
Composition of residue in intermediate solvent accessibility	0.316

AAPeptide016 :

PPSVSEIQLMHNRGKHLNSMERVEWLRKKLQDVHNFPP

Amino acid data

ProtScale

Atomic information

3D Structure

Structural Representation of AAPeptide016

Amino acid data

Secondary structure fraction