AagingBase | Database of anti-aging peptide

AagingBase: Database of anti-aging peptides A manually curated comprehensive database for anti-aging peptides

Peptide Card for AAPeptide014

The Peptide Card page for AAPeptide014 gives textual and graphical visualizations of the properties of AAPeptide014. The users can find all the literature informations collected from scholarly articles and patents and the calculated physicochemical informations. There are also graphical representations hydropathy values, amino acid compositions and frequencies, atomic compositions and secondary structure fractions of AAPeptide014.
To obtain further details, refer to the Help page.

AAP ID	AAPeptide014
Peptide name	Apelin
PubMed/Patent ID	29117554,30061698
Origin	Natural
Source of Origin	Human
Condition addressed	Sarcopenia, Age dependant reduction of apelinergic axis
Experiment type	In vitro, In vivo, Ex vivo
Cell lines/Animal model	Human myoblasts, Human coronary artery endothelial cells (HCAECs), Human cardiac fibroblasts (HCFs), C57BL/6 mice
Intervention	Apln–/–, Aplnr+/– and DN-AMPK mice were used for comparative study after intraperitoneal injection of the peptide, apelin measurements were taken from individuals who performed physical exercise.,Cells were treated with the peptide, Generation of aplnr−/− and apln−/− mice for assessment
Experiment methods	qRT-PCR, Immunohistochemistry, Western blot, In vivo animal imaging of luciferase expression, Histopathology, Pressure myography, Echocardiography, Blood parameter analysis, Cellular proliferation assay, SA-β-gal staining, ML221 treatment and transcription factor array, Exercise stress test (EST)
Patient group	Blood samples from patients who had undergone a comprehensive geriatric assessment (CGA)
Markers used	NA
Mechanism of action	Targets muscle stem cells to enhance muscle regeneration, Promotes mitochondriogenesis and protein synthesis, Reverses age-associated sarcopenia and ameliorates age-associated impairment of cardiovascular and behavioral functions

Molecular weight	8568.980
Peptide length	77
Instability index	57.649
Aromaticity	0.052
Aliphaticity	0.494
Reduced molecular extinction coeffecient	11000
Oxidized molecular extinction coeffecient	11125
Isoelectric point	11.830
Composition of positively charged residues	0.182
Composition of negatively charged residues	0.039
Composition of neutral charged residues	0.779
Composition of residues polar residues	0.143
Composition of residues non-polar residues	0.584
Composition of residues having cyclic side chain	0.104
Composition of acidic residues	0.039
Composition of basic residues	0.182
Composition of residues having cyclic side chain	0.104
Composition of hydroxylic residues	0.065
Composition of residue in buried solvent accessibility	0.468
Composition of residue in exposed solvent accessibility	0.273
Composition of residue in intermediate solvent accessibility	0.234

AAPeptide014 :

MNLRLCVQALLLLWLSLTAVCGGSLMPLPDGNGLEDGNVRHLVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF

Amino acid data

ProtScale

Atomic information

3D Structure

Structural Representation of AAPeptide014

Amino acid data

Secondary structure fraction