AagingBase | Database of anti-aging peptide

AagingBase: Database of anti-aging peptides A manually curated comprehensive database for anti-aging peptides

Peptide Card for AAPeptide001

The Peptide Card page for AAPeptide001 gives textual and graphical visualizations of the properties of AAPeptide001. The users can find all the literature informations collected from scholarly articles and patents and the calculated physicochemical informations. There are also graphical representations hydropathy values, amino acid compositions and frequencies, atomic compositions and secondary structure fractions of AAPeptide001.
To obtain further details, refer to the Help page.

AAP ID	AAPeptide001
Peptide name	Neuropeptide Y
PubMed/Patent ID	11495681
Origin	Natural
Source of Origin	NA
Condition addressed	Immunosenescenece
Experiment type	In vivo
Cell lines/Animal model	BALB/c mice
Intervention	Leucocytes obtained from the mice were treated with the peptide
Experiment methods	NK activity assay, ELISA
Patient group	NA
Markers used	NA
Mechanism of action	Modulates NK activity, with influence on the intracellular cAMP levels

Molecular weight	4272.669
Peptide length	36
Instability index	63.739
Aromaticity	0.139
Aliphaticity	0.361
Reduced molecular extinction coeffecient	7450
Oxidized molecular extinction coeffecient	7450
Isoelectric point	6.762
Composition of positively charged residues	0.167
Composition of negatively charged residues	0.139
Composition of neutral charged residues	0.694
Composition of residues polar residues	0.250
Composition of residues non-polar residues	0.389
Composition of residues having cyclic side chain	0.111
Composition of acidic residues	0.139
Composition of basic residues	0.167
Composition of residues having cyclic side chain	0.111
Composition of hydroxylic residues	0.083
Composition of residue in buried solvent accessibility	0.250
Composition of residue in exposed solvent accessibility	0.361
Composition of residue in intermediate solvent accessibility	0.389

AAPeptide001 :

YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY

Amino acid data

ProtScale

Atomic information

3D Structure

Structural Representation of AAPeptide001

Amino acid data

Secondary structure fraction