Streptomyces_californicus_ADR1_genomic - 36 region(s)

Identified secondary metabolite regions using strictness 'relaxed'

c00002_NODE_2_.. (original name was: NODE_2_length_244139_cov_60.295628)

Region	Type	From	To	Most similar known cluster		Similarity
Region 2.1	melanin	207,259	217,684	melanin	Other	100%

c00005_NODE_5_.. (original name was: NODE_5_length_208672_cov_66.955435)

Region	Type	From	To	Most similar known cluster		Similarity
Region 5.1	NRPS-like	69,449	112,289	WS9326	NRP	7%

c00006_NODE_6_.. (original name was: NODE_6_length_196633_cov_47.103247)

Region	Type	From	To	Most similar known cluster		Similarity
Region 6.1	terpene	73,386	94,363

c00008_NODE_8_.. (original name was: NODE_8_length_188337_cov_47.461239)

Region	Type	From	To	Most similar known cluster		Similarity
Region 8.1	T2PKS	1	47,412	griseorhodin A	Polyketide:Type II	100%

c00009_NODE_9_.. (original name was: NODE_9_length_179919_cov_38.367250)

Region	Type	From	To	Most similar known cluster		Similarity
Region 9.1	ladderane,arylpolyene,NRPS-like	135,029	179,919	atratumycin	NRP	36%

c00010_NODE_10.. (original name was: NODE_10_length_179574_cov_55.483810)

Region	Type	From	To	Most similar known cluster		Similarity
Region 10.1	T1PKS	4,245	47,688

c00012_NODE_12.. (original name was: NODE_12_length_173282_cov_42.009052)

Region	Type	From	To	Most similar known cluster		Similarity
Region 12.1	RiPP-like	112,181	123,650

c00013_NODE_13.. (original name was: NODE_13_length_169269_cov_40.566750)

Region	Type	From	To	Most similar known cluster		Similarity
Region 13.1	terpene	67,733	104,836	isorenieratene	Terpene	100%

c00015_NODE_15.. (original name was: NODE_15_length_150370_cov_37.387127)

Region	Type	From	To	Most similar known cluster		Similarity
Region 15.1	NRPS,T1PKS	9,102	58,575	SGR PTMs	NRP + Polyketide	100%

c00018_NODE_18.. (original name was: NODE_18_length_139895_cov_54.709740)

Region	Type	From	To	Most similar known cluster		Similarity
Region 18.1	siderophore	30,068	41,846	desferrioxamin B	Other	100%
Region 18.2	lanthipeptide-class-iii,lanthipeptide-class-ii	99,258	130,823

c00020_NODE_20.. (original name was: NODE_20_length_132066_cov_63.170243)

Region	Type	From	To	Most similar known cluster		Similarity
Region 20.1	LAP,thiopeptide	71,396	104,636

c00021_NODE_21.. (original name was: NODE_21_length_129409_cov_36.805279)

Region	Type	From	To	Most similar known cluster		Similarity
Region 21.1	NRPS-like	27,156	70,305

c00023_NODE_23.. (original name was: NODE_23_length_116146_cov_42.287835)

Region	Type	From	To	Most similar known cluster		Similarity
Region 23.1	NRPS	7,772	55,028	sporolide A / sporolide B	NRP + Polyketide:Enediyne type I	6%

c00024_NODE_24.. (original name was: NODE_24_length_115951_cov_34.521873)

Region	Type	From	To	Most similar known cluster		Similarity
Region 24.1	melanin	20,273	30,746	melanin	Other	100%

c00025_NODE_25.. (original name was: NODE_25_length_115513_cov_39.924094)

Region	Type	From	To	Most similar known cluster		Similarity
Region 25.1	NRPS,other	8,598	79,353	mitomycin	Other:Aminocoumarin	18%

c00026_NODE_26.. (original name was: NODE_26_length_112648_cov_41.535744)

Region	Type	From	To	Most similar known cluster		Similarity
Region 26.1	ectoine	71,914	82,312	ectoine	Other	100%

c00028_NODE_28.. (original name was: NODE_28_length_106781_cov_78.058177)

Region	Type	From	To	Most similar known cluster		Similarity
Region 28.1	butyrolactone,ectoine	58,003	73,470	showdomycin	Other	47%

c00029_NODE_29.. (original name was: NODE_29_length_106535_cov_44.090252)

Region	Type	From	To	Most similar known cluster		Similarity
Region 29.1	siderophore	53,350	68,236

c00030_NODE_30.. (original name was: NODE_30_length_104959_cov_34.057920)

Region	Type	From	To	Most similar known cluster		Similarity
Region 30.1	phosphonate	1	34,127	rhizocticin A	Other	9%
Region 30.2	T1PKS,NRPS	72,109	104,959	kanamycin	Saccharide	2%

c00031_NODE_31.. (original name was: NODE_31_length_100296_cov_34.533015)

Region	Type	From	To	Most similar known cluster		Similarity
Region 31.1	NRPS	1	36,719	streptobactin	NRP	76%
Region 31.2	terpene	75,947	98,181	geosmin	Terpene	100%

c00032_NODE_32.. (original name was: NODE_32_length_97320_cov_34.643551)

Region	Type	From	To	Most similar known cluster		Similarity
Region 32.1	T3PKS	43,298	84,350	tetronasin	Polyketide	11%

c00035_NODE_35.. (original name was: NODE_35_length_93352_cov_52.923502)

Region	Type	From	To	Most similar known cluster		Similarity
Region 35.1	T3PKS	64,520	93,352

c00048_NODE_48.. (original name was: NODE_48_length_76030_cov_34.410201)

Region	Type	From	To	Most similar known cluster		Similarity
Region 48.1	T3PKS	46,956	76,030	herboxidiene	Polyketide	6%

c00049_NODE_49.. (original name was: NODE_49_length_74745_cov_34.748320)

Region	Type	From	To	Most similar known cluster		Similarity
Region 49.1	butyrolactone	44,485	55,411	coelimycin P1	Polyketide:Modular type I	12%

c00054_NODE_54.. (original name was: NODE_54_length_64950_cov_50.420125)

Region	Type	From	To	Most similar known cluster		Similarity
Region 54.1	lanthipeptide-class-iii	40,434	63,187	AmfS	RiPP:Lanthipeptide	100%

c00056_NODE_56.. (original name was: NODE_56_length_59316_cov_53.358752)

Region	Type	From	To	Most similar known cluster		Similarity
Region 56.1	thiopeptide,thioamitides	1	25,467

c00057_NODE_57.. (original name was: NODE_57_length_56397_cov_38.055412)

Region	Type	From	To	Most similar known cluster		Similarity
Region 57.1	terpene	1	26,548	hopene	Terpene	69%

c00060_NODE_60.. (original name was: NODE_60_length_54061_cov_77.603026)

Region	Type	From	To	Most similar known cluster		Similarity
Region 60.1	lassopeptide	21,625	44,448	keywimysin	RiPP	100%

c00061_NODE_61.. (original name was: NODE_61_length_53110_cov_34.505193)

Region	Type	From	To	Most similar known cluster		Similarity
Region 61.1	NRPS	757	51,697	coelichelin	NRP	81%

c00070_NODE_70.. (original name was: NODE_70_length_38143_cov_37.483013)

Region	Type	From	To	Most similar known cluster		Similarity
Region 70.1	NRPS,NRPS-like	1	38,143	viomycin	NRP	90%

c00088_NODE_88.. (original name was: NODE_88_length_17008_cov_41.555182)

Region	Type	From	To	Most similar known cluster		Similarity
Region 88.1	T1PKS,NRPS-like	1	17,008

c00102_NODE_10.. (original name was: NODE_102_length_9777_cov_75.103374)

Region	Type	From	To	Most similar known cluster		Similarity
Region 102.1	lanthipeptide-class-i	1	9,777

c00131_NODE_13.. (original name was: NODE_131_length_2135_cov_96.334135)

Region	Type	From	To	Most similar known cluster		Similarity
Region 131.1	siderophore	1	2,135	desferrioxamin B	Other	60%

No secondary metabolite regions were found in these records:: c00001_NODE_1_.. (original name was: NODE_1_length_285075_cov_72.750530); c00003_NODE_3_.. (original name was: NODE_3_length_218341_cov_58.994544); c00004_NODE_4_.. (original name was: NODE_4_length_212761_cov_55.048682); c00007_NODE_7_.. (original name was: NODE_7_length_195260_cov_65.606890); c00011_NODE_11.. (original name was: NODE_11_length_174331_cov_38.865811); c00014_NODE_14.. (original name was: NODE_14_length_155017_cov_50.852990); c00016_NODE_16.. (original name was: NODE_16_length_150365_cov_43.359770); c00017_NODE_17.. (original name was: NODE_17_length_144833_cov_40.472275); c00019_NODE_19.. (original name was: NODE_19_length_134290_cov_39.135494); c00022_NODE_22.. (original name was: NODE_22_length_123171_cov_82.950153); c00027_NODE_27.. (original name was: NODE_27_length_108490_cov_43.843270); c00033_NODE_33.. (original name was: NODE_33_length_96815_cov_81.676860); c00034_NODE_34.. (original name was: NODE_34_length_96354_cov_42.335403); c00036_NODE_36.. (original name was: NODE_36_length_90939_cov_45.178480); c00037_NODE_37.. (original name was: NODE_37_length_88137_cov_45.642504); c00038_NODE_38.. (original name was: NODE_38_length_87435_cov_39.805573); c00039_NODE_39.. (original name was: NODE_39_length_86218_cov_42.577568); c00040_NODE_40.. (original name was: NODE_40_length_83869_cov_42.875928); c00041_NODE_41.. (original name was: NODE_41_length_82712_cov_39.424380); c00042_NODE_42.. (original name was: NODE_42_length_82649_cov_43.167058); c00043_NODE_43.. (original name was: NODE_43_length_81275_cov_44.923147); c00044_NODE_44.. (original name was: NODE_44_length_81104_cov_78.498933); c00045_NODE_45.. (original name was: NODE_45_length_80763_cov_51.214266); c00046_NODE_46.. (original name was: NODE_46_length_79473_cov_49.674104); c00047_NODE_47.. (original name was: NODE_47_length_77757_cov_35.711964); c00050_NODE_50.. (original name was: NODE_50_length_70930_cov_51.893305); c00051_NODE_51.. (original name was: NODE_51_length_67571_cov_67.388945); c00052_NODE_52.. (original name was: NODE_52_length_66507_cov_70.191597); c00053_NODE_53.. (original name was: NODE_53_length_66368_cov_80.964683); c00055_NODE_55.. (original name was: NODE_55_length_59879_cov_78.986861); c00058_NODE_58.. (original name was: NODE_58_length_56011_cov_44.215848); c00059_NODE_59.. (original name was: NODE_59_length_54222_cov_48.721048); c00062_NODE_62.. (original name was: NODE_62_length_52686_cov_38.004541); c00063_NODE_63.. (original name was: NODE_63_length_49899_cov_74.360384); c00064_NODE_64.. (original name was: NODE_64_length_46566_cov_56.025736); c00065_NODE_65.. (original name was: NODE_65_length_45401_cov_61.209611); c00066_NODE_66.. (original name was: NODE_66_length_44950_cov_53.568927); c00067_NODE_67.. (original name was: NODE_67_length_42645_cov_50.979267); c00068_NODE_68.. (original name was: NODE_68_length_41126_cov_41.185703); c00069_NODE_69.. (original name was: NODE_69_length_38734_cov_45.059309); c00071_NODE_71.. (original name was: NODE_71_length_37484_cov_40.471372); c00072_NODE_72.. (original name was: NODE_72_length_30643_cov_40.941317); c00073_NODE_73.. (original name was: NODE_73_length_30394_cov_70.604437); c00074_NODE_74.. (original name was: NODE_74_length_30121_cov_44.673884); c00075_NODE_75.. (original name was: NODE_75_length_29319_cov_40.684185); c00076_NODE_76.. (original name was: NODE_76_length_26430_cov_68.823621); c00077_NODE_77.. (original name was: NODE_77_length_24747_cov_48.246112); c00078_NODE_78.. (original name was: NODE_78_length_22789_cov_79.789962); c00079_NODE_79.. (original name was: NODE_79_length_22362_cov_73.177926); c00080_NODE_80.. (original name was: NODE_80_length_21385_cov_73.375387); c00081_NODE_81.. (original name was: NODE_81_length_20982_cov_43.281837); c00082_NODE_82.. (original name was: NODE_82_length_20756_cov_33.123569); c00083_NODE_83.. (original name was: NODE_83_length_20743_cov_75.329901); c00084_NODE_84.. (original name was: NODE_84_length_19873_cov_33.816581); c00085_NODE_85.. (original name was: NODE_85_length_19692_cov_71.346794); c00086_NODE_86.. (original name was: NODE_86_length_19181_cov_51.956133); c00087_NODE_87.. (original name was: NODE_87_length_18122_cov_80.587314); c00089_NODE_89.. (original name was: NODE_89_length_16384_cov_35.750322); c00090_NODE_90.. (original name was: NODE_90_length_16135_cov_44.620336); c00091_NODE_91.. (original name was: NODE_91_length_16003_cov_39.222222); c00092_NODE_92.. (original name was: NODE_92_length_15412_cov_55.888715); c00093_NODE_93.. (original name was: NODE_93_length_15260_cov_75.929826); c00094_NODE_94.. (original name was: NODE_94_length_14199_cov_128.553450); c00095_NODE_95.. (original name was: NODE_95_length_13235_cov_43.058725); c00096_NODE_96.. (original name was: NODE_96_length_13226_cov_171.214714); c00097_NODE_97.. (original name was: NODE_97_length_12452_cov_56.474470); c00098_NODE_98.. (original name was: NODE_98_length_11412_cov_51.499868); c00099_NODE_99.. (original name was: NODE_99_length_11114_cov_50.579709); c00100_NODE_10.. (original name was: NODE_100_length_10607_cov_39.379359); c00101_NODE_10.. (original name was: NODE_101_length_9953_cov_75.935340); c00103_NODE_10.. (original name was: NODE_103_length_9401_cov_76.234325); c00104_NODE_10.. (original name was: NODE_104_length_9011_cov_39.523001); c00105_NODE_10.. (original name was: NODE_105_length_8433_cov_44.961089); c00106_NODE_10.. (original name was: NODE_106_length_8233_cov_75.320249); c00107_NODE_10.. (original name was: NODE_107_length_8133_cov_49.965462); c00108_NODE_10.. (original name was: NODE_108_length_7510_cov_34.784842); c00109_NODE_10.. (original name was: NODE_109_length_6997_cov_70.747479); c00110_NODE_11.. (original name was: NODE_110_length_6922_cov_52.861803); c00111_NODE_11.. (original name was: NODE_111_length_6808_cov_83.151488); c00112_NODE_11.. (original name was: NODE_112_length_6626_cov_39.344849); c00113_NODE_11.. (original name was: NODE_113_length_6100_cov_55.923573); c00114_NODE_11.. (original name was: NODE_114_length_5986_cov_55.234699); c00115_NODE_11.. (original name was: NODE_115_length_5720_cov_85.389762); c00116_NODE_11.. (original name was: NODE_116_length_5516_cov_43.858085); c00117_NODE_11.. (original name was: NODE_117_length_5492_cov_128.642634); c00118_NODE_11.. (original name was: NODE_118_length_5281_cov_48.798507); c00119_NODE_11.. (original name was: NODE_119_length_5160_cov_365.775122); c00120_NODE_12.. (original name was: NODE_120_length_5050_cov_46.963564); c00121_NODE_12.. (original name was: NODE_121_length_5046_cov_45.662593); c00122_NODE_12.. (original name was: NODE_122_length_4932_cov_51.794136); c00123_NODE_12.. (original name was: NODE_123_length_4186_cov_78.264585); c00124_NODE_12.. (original name was: NODE_124_length_4074_cov_80.867131); c00125_NODE_12.. (original name was: NODE_125_length_4025_cov_67.244081); c00126_NODE_12.. (original name was: NODE_126_length_3410_cov_82.351714); c00127_NODE_12.. (original name was: NODE_127_length_3249_cov_75.686913); c00128_NODE_12.. (original name was: NODE_128_length_2965_cov_32.663918); c00129_NODE_12.. (original name was: NODE_129_length_2782_cov_79.080675); c00130_NODE_13.. (original name was: NODE_130_length_2700_cov_45.423819); c00132_NODE_13.. (original name was: NODE_132_length_2033_cov_37.131951); c00133_NODE_13.. (original name was: NODE_133_length_2031_cov_71.829960); c00134_NODE_13.. (original name was: NODE_134_length_2026_cov_43.172501); c00135_NODE_13.. (original name was: NODE_135_length_1907_cov_54.489741); c00136_NODE_13.. (original name was: NODE_136_length_1897_cov_81.458198); c00137_NODE_13.. (original name was: NODE_137_length_1859_cov_82.064302); c00138_NODE_13.. (original name was: NODE_138_length_1725_cov_54.711976); c00139_NODE_13.. (original name was: NODE_139_length_1609_cov_128.359073); c00140_NODE_14.. (original name was: NODE_140_length_1600_cov_45.530097); c00141_NODE_14.. (original name was: NODE_141_length_1563_cov_105.518568); c00142_NODE_14.. (original name was: NODE_142_length_1527_cov_81.701087); c00143_NODE_14.. (original name was: NODE_143_length_1364_cov_190.491979); c00144_NODE_14.. (original name was: NODE_144_length_1317_cov_96.567353); c00145_NODE_14.. (original name was: NODE_145_length_1255_cov_51.517500); c00146_NODE_14.. (original name was: NODE_146_length_1235_cov_95.837288); c00147_NODE_14.. (original name was: NODE_147_length_1214_cov_92.174288); c00148_NODE_14.. (original name was: NODE_148_length_1104_cov_102.569113); c00149_NODE_14.. (original name was: NODE_149_length_1004_cov_38.095890)

Compact view

c00002_NODE_2_.. - Region 1 - melanin

Download region GenBank file

Download region SVG

Location: 207,259 - 217,684 nt. (total: 10,426 nt) Show pHMM detection rules used

melanin: melC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

c00005_NODE_5_.. - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 69,449 - 112,289 nt. (total: 42,841 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 69448 - 112289:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg5_81

Search NORINE for peptide: strict or relaxed

AMP-binding (320..764): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWSVGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

ctg5_88

Search NORINE for peptide: strict or relaxed

AMP-binding (59..402): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DArl--GgsK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 40% (weak)

c00006_NODE_6_.. - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 73,386 - 94,363 nt. (total: 20,978 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

c00008_NODE_8_.. - Region 1 - T2PKS

Download region GenBank file

Download region SVG

Location: 1 - 47,412 nt. (total: 47,412 nt) Show pHMM detection rules used

Region on contig edge.

T2PKS: (t2ks and t2clf)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

Type II PKS

Type II PKS gene cluster prediction details

Cluster section:: 0 to 47412
Starter unit(s):: malonamyl-CoA (Score: 540.0; E-value: 0)
Malonyl elongations:: 11|12 (Score: 701.0; E-value: 8.7e-214)
Product molecular weight(s):: malonamyl-CoA_11: 553.56 Da
malonamyl-CoA_12: 595.59 Da

ctg8_10: KR C19 (Score: 425.7; E-value: 1.3e-130)
ctg8_11: CYC C9-C14 (Score: 246.0; E-value: 2.6e-76); KR C11 (Score: 266.8; E-value: 3.8e-82)
ctg8_12: CLF 11|12 (Score: 701.0; E-value: 8.7e-214)
ctg8_13: KS (Score: 749.1; E-value: 2.9e-228)
ctg8_14: CYC C5-C18 (Score: 217.3; E-value: 1.3e-67)
ctg8_15: CYC C4-C21/C2-C23|C2-C19 (Score: 179.7; E-value: 2.6e-56)
ctg8_16: AMID (Score: 717.9; E-value: 1.9e-218); AMID CAM34350.1_Lysolipin_malonamyl-CoA (Score: 540.0; E-value: 0.0)
ctg8_19: OXY (Score: 301.4; E-value: 3.1e-92)
ctg8_20: OXY (Score: 299.1; E-value: 1.5e-91)
ctg8_21: MET C13O|C17O (Score: 396.4; E-value: 2e-121)
ctg8_24: OXY (Score: 445.4; E-value: 6.5e-136)
ctg8_26: OXY (Score: 268.3; E-value: 3.2e-82)
ctg8_30: KR (Score: 195.0; E-value: 4.3e-60)
ctg8_37: CYC C7-C12 (Score: 307.1; E-value: 2.4e-94)
ctg8_38: ACP (Score: 92.5; E-value: 2.8e-29)

c00009_NODE_9_.. - Region 1 - NRPS-like,arylpolyene,ladderane

Download region GenBank file

Download region SVG

Location: 135,029 - 179,919 nt. (total: 44,891 nt) Show pHMM detection rules used

Region on contig edge.

ladderane: ladderane
arylpolyene: (APE_KS1 or APE_KS2)
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 145991 - 179919:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg9_148

PKS_AT (8..294): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 75.0%; inactive: 58.3%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 87.3
Methoxymalonyl-CoA: 51.3
Methylmalonyl-CoA: 44.6
inactive: 29.9
Propionyl-CoA: 21.9
trans-1,2-CPDA: 17.4
CHC-CoA: 17.4
Ethylmalonyl-CoA: 17.2
2-Methylbutyryl-CoA: 16.5
Acetyl-CoA: 8.6
fatty_acid: 5.2
Benzoyl-CoA: 2.4
Isobutyryl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

ctg9_149

Search NORINE for peptide: strict or relaxed

AMP-binding (16..423): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: vaefVGAaGK
Nearest Stachelhaus code:: tcl
Stachelhaus code match:: 50% (weak)

c00010_NODE_10.. - Region 1 - T1PKS

Download region GenBank file

Download region SVG

Location: 4,245 - 47,688 nt. (total: 43,444 nt) Show pHMM detection rules used

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

No matches found.

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 4244 - 47688:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (mal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg10_24

PKS_AT (582..876): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%; inactive: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 119.2
inactive: 71.5
Methylmalonyl-CoA: 57.2
Methoxymalonyl-CoA: 56.9
Isobutyryl-CoA: 36.9
Propionyl-CoA: 35.7
Ethylmalonyl-CoA: 32.0
CHC-CoA: 31.8
fatty_acid: 21.9
2-Methylbutyryl-CoA: 17.0
Benzoyl-CoA: 16.4
trans-1,2-CPDA: 13.0
Acetyl-CoA: 11.5
3-Methylbutyryl-CoA: 9.3

c00012_NODE_12.. - Region 1 - RiPP-like

Download region GenBank file

Download region SVG

Location: 112,181 - 123,650 nt. (total: 11,470 nt) Show pHMM detection rules used

RiPP-like: (strepbact or Antimicrobial14 or Bacteriocin_IId or BacteriocIIc_cy or Bacteriocin_II or Bacteriocin_IIi or Lactococcin or Antimicrobial17 or Lactococcin_972 or Bacteriocin_IIc or LcnG-beta or Cloacin or Linocin_M18 or TIGR03651 or TIGR03693 or TIGR03601 or TIGR03795 or TIGR03975 or DUF692 or TIGR01193)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

c00013_NODE_13.. - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 67,733 - 104,836 nt. (total: 37,104 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

c00015_NODE_15.. - Region 1 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 9,102 - 58,575 nt. (total: 49,474 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))
T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 9101 - 58575:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (pk - orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg15_28

Search NORINE for peptide: strict or relaxed

PKS_AT (552..848): pk

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 70.8%

minowa: Methylmalonyl-CoA

Prediction, score:

Methylmalonyl-CoA: 126.3
Methoxymalonyl-CoA: 115.4
Malonyl-CoA: 110.1
Ethylmalonyl-CoA: 99.8
Isobutyryl-CoA: 87.2
Propionyl-CoA: 73.3
Acetyl-CoA: 67.6
2-Methylbutyryl-CoA: 66.2
trans-1,2-CPDA: 64.6
Benzoyl-CoA: 61.4
fatty_acid: 52.9
CHC-CoA: 47.3
3-Methylbutyryl-CoA: 34.6
inactive: 30.1

AMP-binding (2331..2744): orn

NRPSPredictor2: orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: orn, horn
Single AA prediction:: orn

Stachelhaus prediction details:

Stachelhaus sequence:: DVGEVGSIDK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 100% (strong)

c00018_NODE_18.. - Region 1 - siderophore

Download region GenBank file

Download region SVG

Location: 30,068 - 41,846 nt. (total: 11,779 nt) Show pHMM detection rules used

siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

c00018_NODE_18.. - Region 2 - lanthipeptide-class-ii,lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 99,258 - 130,823 nt. (total: 31,566 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)
lanthipeptide-class-ii: cds(LANC_like and DUF4135)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Lanthipeptides

Similar known gene clusters

No matches found.

Lanthipeptide predictions

Lanthipeptide(s) for ctg18_91 - Putative Class II

allorf_104777_104992 leader / core peptide: VRSGVGGA - RVARGVERGGVGRVWRRCAKGRAGWDhbVRPGGDhaGDhbGRGVAPRRARDhbAGDhbGHRPPVHCPQVDhbGFR
allorf_114035_114178 leader / core peptide: VASRMGARPGG - MGAPGGFGRVRGRKMRVAPRCAGVGCGRDhbIGDhbCVRP
allorf_121010_121126 leader / core peptide: VCSSGRKMGATPPCARTPSPATMNAG - GPDhbGPGPGPGRC
allorf_114035_114178 leader / core peptide: VASRMGARPGG - MGAPGGFGRVRGRKMRVAPRCAGVGCGRDhbIGDhbCVRP
allorf_121010_121126 leader / core peptide: VCSSGRKMGATPPCARTPSPATMNAG - GPDhbGPGPGPGRC

Lanthipeptide(s) for ctg18_95 - Putative Class II

allorf_114035_114178 leader / core peptide: VASRMGARPGG - MGAPGGFGRVRGRKMRVAPRCAGVGCGRDhbIGDhbCVRP
allorf_121010_121126 leader / core peptide: VCSSGRKMGATPPCARTPSPATMNAG - GPDhbGPGPGPGRC
allorf_114035_114178 leader / core peptide: VASRMGARPGG - MGAPGGFGRVRGRKMRVAPRCAGVGCGRDhbIGDhbCVRP
allorf_121010_121126 leader / core peptide: VCSSGRKMGATPPCARTPSPATMNAG - GPDhbGPGPGPGRC

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

allorf_104777_104992 - Class II

Cleavage pHMM score: -6.90

RODEO score: 0

Monoisotopic mass: 6574.6 Da

Molecular weight: 6578.5 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 6596.5 Da N = 1; 6614.5 Da N = 2; 6632.5 Da N = 3; 6650.6 Da N = 4

allorf_114035_114178 - Class II

Cleavage pHMM score: -4.60

RODEO score: 0

Monoisotopic mass: 3649.9 Da

Molecular weight: 3652.4 Da

Number of bridges: 2

allorf_121010_121126 - Class II

Cleavage pHMM score: -6.60

RODEO score: 0

Monoisotopic mass: 1033.5 Da

Molecular weight: 1034.1 Da

Number of bridges: 1

allorf_114035_114178 - Class II

Cleavage pHMM score: -4.60

RODEO score: 0

Monoisotopic mass: 3649.9 Da

Molecular weight: 3652.4 Da

Number of bridges: 2

allorf_121010_121126 - Class II

Cleavage pHMM score: -6.60

RODEO score: 0

Monoisotopic mass: 1033.5 Da

Molecular weight: 1034.1 Da

Number of bridges: 1

allorf_114035_114178 - Class II

Cleavage pHMM score: -4.60

RODEO score: 0

Monoisotopic mass: 3649.9 Da

Molecular weight: 3652.4 Da

Number of bridges: 2

allorf_121010_121126 - Class II

Cleavage pHMM score: -6.60

RODEO score: 0

Monoisotopic mass: 1033.5 Da

Molecular weight: 1034.1 Da

Number of bridges: 1

allorf_114035_114178 - Class II

Cleavage pHMM score: -4.60

RODEO score: 0

Monoisotopic mass: 3649.9 Da

Molecular weight: 3652.4 Da

Number of bridges: 2

allorf_121010_121126 - Class II

Cleavage pHMM score: -6.60

RODEO score: 0

Monoisotopic mass: 1033.5 Da

Molecular weight: 1034.1 Da

Number of bridges: 1

c00020_NODE_20.. - Region 1 - LAP,thiopeptide

Download region GenBank file

Download region SVG

Location: 71,396 - 104,636 nt. (total: 33,241 nt) Show pHMM detection rules used

LAP: ((((goadsporin_like or PF00881 or TIGR03605) and (YcaO or TIGR03882 or TIGR03604)) or TIGR03603 or TIGR03602) and not cyanobactin_synth)
thiopeptide: ((YcaO or TIGR03882) and ((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or PF07366 or PF06968 or PF04055) or thiostrepton)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Thiopeptides

Similar known gene clusters

No matches found.

Thiopeptide predictions

No core peptides found.

Thiopeptides

Core peptide predictions

No core peptides found.

c00021_NODE_21.. - Region 1 - NRPS-like

Download region GenBank file

Download region SVG

Location: 27,156 - 70,305 nt. (total: 43,150 nt) Show pHMM detection rules used

NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

No matches found.

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 27155 - 70305:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (val)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg21_48

Search NORINE for peptide: strict or relaxed

AMP-binding (31..431): val

NRPSPredictor2: val

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: gly, ala, val, leu, ile, abu, iva
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVFWIGGvFK
Nearest Stachelhaus code:: val
Stachelhaus code match:: 90% (moderate)

c00023_NODE_23.. - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 7,772 - 55,028 nt. (total: 47,257 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 7771 - 55028:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ser - pro)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg23_15

Search NORINE for peptide: strict or relaxed

AMP-binding (19..422): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVQFvAqVVK
Nearest Stachelhaus code:: pro
Stachelhaus code match:: 80% (moderate)

ctg23_25

Search NORINE for peptide: strict or relaxed

AMP-binding (480..886): ser

NRPSPredictor2: ser

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: ser
Single AA prediction:: ser

Stachelhaus prediction details:

Stachelhaus sequence:: DVWHFSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 100% (strong)

AMP-binding (1541..1941): pro

NRPSPredictor2: pro

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: pro, pip
Small clusters prediction:: pro
Single AA prediction:: pro

Stachelhaus prediction details:

Stachelhaus sequence:: DVqHcShaaK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 50% (weak)

c00024_NODE_24.. - Region 1 - melanin

Download region GenBank file

Download region SVG

Location: 20,273 - 30,746 nt. (total: 10,474 nt) Show pHMM detection rules used

melanin: melC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

c00025_NODE_25.. - Region 1 - NRPS,other

Download region GenBank file

Download region SVG

Location: 8,598 - 79,353 nt. (total: 70,756 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))
other: (LmbU or Neocarzinostat or fom1 or bcpB or frbD or mitE or vlmB or prnB or CaiA or bacilysin or orf2_PTase)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 8597 - 79353:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (cys)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 8597 - 52830:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (cys)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg25_22

Search NORINE for peptide: strict or relaxed

AMP-binding (559..958): cys

NRPSPredictor2: cys

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: cys
Small clusters prediction:: cys
Single AA prediction:: cys

Stachelhaus prediction details:

Stachelhaus sequence:: DLFNMSLIWK
Nearest Stachelhaus code:: cys
Stachelhaus code match:: 100% (strong)

ctg25_47

Search NORINE for peptide: strict or relaxed

AMP-binding (20..343): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: N/A
Large clusters prediction:: N/A
Small clusters prediction:: val, leu, ile, abu, iva
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: aygpMGdslK
Nearest Stachelhaus code:: phe
Stachelhaus code match:: 30% (weak)

c00026_NODE_26.. - Region 1 - ectoine

Download region GenBank file

Download region SVG

Location: 71,914 - 82,312 nt. (total: 10,399 nt) Show pHMM detection rules used

ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

c00028_NODE_28.. - Region 1 - butyrolactone,ectoine

Download region GenBank file

Download region SVG

Location: 58,003 - 73,470 nt. (total: 15,468 nt) Show pHMM detection rules used

butyrolactone: AfsA
ectoine: ectoine_synt

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

c00029_NODE_29.. - Region 1 - siderophore

Download region GenBank file

Download region SVG

Location: 53,350 - 68,236 nt. (total: 14,887 nt) Show pHMM detection rules used

siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

c00030_NODE_30.. - Region 1 - phosphonate

Download region GenBank file

Download region SVG

Location: 1 - 34,127 nt. (total: 34,127 nt) Show pHMM detection rules used

Region on contig edge.

phosphonate: phosphonates

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

c00030_NODE_30.. - Region 2 - NRPS,T1PKS

Download region GenBank file

Download region SVG

Location: 72,109 - 104,959 nt. (total: 32,851 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 2, location 72108 - 104959:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (ohmal) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg30_90

CAL_domain (42..453): pk

minowa: NH2

Prediction, score:

NH2: 46.8
fatty_acid: 34.8
shikimic_acid: 0.0
Acetyl-CoA: 0.0
AHBA: 0.0

PKS_AT (1255..1540): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 79.2%; inactive: 66.7%; Methylmalonyl-CoA: 58.3%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 112.7
Methylmalonyl-CoA: 71.6
Methoxymalonyl-CoA: 71.6
inactive: 47.3
Propionyl-CoA: 36.7
Ethylmalonyl-CoA: 35.6
Isobutyryl-CoA: 32.3
fatty_acid: 27.8
2-Methylbutyryl-CoA: 25.1
CHC-CoA: 19.4
trans-1,2-CPDA: 17.3
Benzoyl-CoA: 15.2
Acetyl-CoA: 14.6
3-Methylbutyryl-CoA: 0.0

ctg30_91

Search NORINE for peptide: strict or relaxed

AMP-binding (1133..1549): X

NRPSPredictor2: asp, asn, glu, gln, aad

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DArshGLInK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 60% (weak)

c00031_NODE_31.. - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 1 - 36,719 nt. (total: 36,719 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 36719:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - thr)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg31_1

Search NORINE for peptide: strict or relaxed

AMP-binding (32..439): dhb

NRPSPredictor2: dhb

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aromatic
Large clusters prediction:: dhb, sal
Small clusters prediction:: dhb, sal
Single AA prediction:: dhb

Stachelhaus prediction details:

Stachelhaus sequence:: PLPglGVVNK
Nearest Stachelhaus code:: dhb
Stachelhaus code match:: 80% (moderate)

ctg31_8

Search NORINE for peptide: strict or relaxed

AMP-binding (478..924): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAwDVGLVDK
Nearest Stachelhaus code:: arg
Stachelhaus code match:: 90% (moderate)

AMP-binding (1616..2023): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNVGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

c00031_NODE_31.. - Region 2 - terpene

Download region GenBank file

Download region SVG

Location: 75,947 - 98,181 nt. (total: 22,235 nt) Show pHMM detection rules used

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

c00032_NODE_32.. - Region 1 - T3PKS

Download region GenBank file

Download region SVG

Location: 43,298 - 84,350 nt. (total: 41,053 nt) Show pHMM detection rules used

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

c00035_NODE_35.. - Region 1 - T3PKS

Download region GenBank file

Download region SVG

Location: 64,520 - 93,352 nt. (total: 28,833 nt) Show pHMM detection rules used

Region on contig edge.

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

No matches found.

c00048_NODE_48.. - Region 1 - T3PKS

Download region GenBank file

Download region SVG

Location: 46,956 - 76,030 nt. (total: 29,075 nt) Show pHMM detection rules used

Region on contig edge.

T3PKS: (Chal_sti_synt_C or Chal_sti_synt_N)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

c00049_NODE_49.. - Region 1 - butyrolactone

Download region GenBank file

Download region SVG

Location: 44,485 - 55,411 nt. (total: 10,927 nt) Show pHMM detection rules used

butyrolactone: AfsA

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

c00054_NODE_54.. - Region 1 - lanthipeptide-class-iii

Download region GenBank file

Download region SVG

Location: 40,434 - 63,187 nt. (total: 22,754 nt) Show pHMM detection rules used

lanthipeptide-class-iii: (micKC and not PKS_KS)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Lanthipeptides

Similar known gene clusters

Lanthipeptide predictions

Lanthipeptide(s) for ctg54_50 - Putative Class III

ctg54_49 leader / core peptide: MALLDLQAMDTPAEDSFGELAT - GDhaQVDhaVLVCEYDhaDhaLDhaVVLCDhbP

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

ctg54_49 - Class III

Cleavage pHMM score: 31.80

RODEO score: 0

Monoisotopic mass: 2061.1 Da

Molecular weight: 2062.4 Da

Number of bridges: 2

Alternative weights: (assuming N unmodified Ser/Thr residues); 2080.4 Da N = 1; 2098.4 Da N = 2; 2116.4 Da N = 3; 2134.5 Da N = 4

c00056_NODE_56.. - Region 1 - thioamitides,thiopeptide

Download region GenBank file

Download region SVG

Location: 1 - 25,467 nt. (total: 25,467 nt) Show pHMM detection rules used

Region on contig edge.

thiopeptide: ((YcaO or TIGR03882) and ((thio_amide and (PF06968 or PF04055 or PF07366)) or Lant_dehydr_C or Lant_dehydr_N or PF07366 or PF06968 or PF04055) or thiostrepton)
thioamitides: ((YcaO or TIGR03882) and TfuA)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Thiopeptides

Similar known gene clusters

No matches found.

Thiopeptide predictions

No core peptides found.

Thiopeptides

Core peptide predictions

No core peptides found.

c00057_NODE_57.. - Region 1 - terpene

Download region GenBank file

Download region SVG

Location: 1 - 26,548 nt. (total: 26,548 nt) Show pHMM detection rules used

Region on contig edge.

terpene: (Terpene_synth or Terpene_synth_C or phytoene_synt or Lycopene_cycl or terpene_cyclase or NapT7 or fung_ggpps or fung_ggpps2 or trichodiene_synth or TRI5)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters

c00060_NODE_60.. - Region 1 - lassopeptide

Download region GenBank file

Download region SVG

Location: 21,625 - 44,448 nt. (total: 22,824 nt) Show pHMM detection rules used

lassopeptide: (PF13471 and Asn_synthase or micJ25 or mcjC)

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Lasso peptides

Similar known gene clusters

Lasso peptide predictions

Lassopeptide(s) for ctg60_30 - Putative Class II

ctg60_30 leader / core peptide / cleaved tail: MKQQKKAYVKPSLFKQGDFSKKTA - GYFYGSYKEYWVRRII

Legend:

Red: Putative macrolactam
Purple: Putative cleaved off residues

Lasso peptides

Core peptide predictions

ctg60_30 - Class II: Cleavage pHMM score: 0.20; RODEO score: 22; Monoisotopic mass: 2081.0 Da; Molecular weight: 2082.4 Da; Number of bridges: 0

c00061_NODE_61.. - Region 1 - NRPS

Download region GenBank file

Download region SVG

Location: 757 - 51,697 nt. (total: 50,941 nt) Show pHMM detection rules used

NRPS: cds(Condensation and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 756 - 51697:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (D-orn - D-thr - orn)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg61_21

Search NORINE for peptide: strict or relaxed

AMP-binding (144..542): orn

NRPSPredictor2: orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: orn, horn
Single AA prediction:: orn

Stachelhaus prediction details:

Stachelhaus sequence:: DINYWGGIGK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 100% (strong)

AMP-binding (1624..2044): thr

NRPSPredictor2: thr

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: ser, thr, dhpg, hpg
Small clusters prediction:: thr
Single AA prediction:: thr

Stachelhaus prediction details:

Stachelhaus sequence:: DFWNVGMVHK
Nearest Stachelhaus code:: thr
Stachelhaus code match:: 100% (strong)

AMP-binding (3066..3464): orn

NRPSPredictor2: orn

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: orn, lys, arg
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DMwNLGLINK
Nearest Stachelhaus code:: orn
Stachelhaus code match:: 90% (moderate)

c00070_NODE_70.. - Region 1 - NRPS,NRPS-like

Download region GenBank file

Download region SVG

Location: 1 - 38,143 nt. (total: 38,143 nt) Show pHMM detection rules used

Region on contig edge.

NRPS: cds(Condensation and (AMP-binding or A-OX))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 38143:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X - glu) + (X) + (cap) + (X)

Direct lookup in NORINE database: strict or relaxed

For candidate cluster 2, location 83 - 31209:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (cap) + (X)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg70_13

Search NORINE for peptide: strict or relaxed

AMP-binding (22..421): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DTEdVGTmVK
Nearest Stachelhaus code:: lys-b
Stachelhaus code match:: 80% (moderate)

ctg70_21

Search NORINE for peptide: strict or relaxed

AMP-binding (47..464): cap

NRPSPredictor2: cap

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DPQDVGIVNK
Nearest Stachelhaus code:: cap
Stachelhaus code match:: 100% (strong)

ctg70_22

Search NORINE for peptide: strict or relaxed

AMP-binding (41..463): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DAQDLaiVDK
Nearest Stachelhaus code:: gln
Stachelhaus code match:: 80% (moderate)

ctg70_27

Search NORINE for peptide: strict or relaxed

AMP-binding (36..440): X

NRPSPredictor2: (unknown)

SVM prediction details:

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: glu, gln
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: DVyHFSLVDK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 90% (moderate)

AMP-binding (1092..1496): glu

NRPSPredictor2: glu

SVM prediction details:

Predicted physicochemical class:: hydrophilic
Large clusters prediction:: asp, asn, glu, gln, aad
Small clusters prediction:: N/A
Single AA prediction:: glu

Stachelhaus prediction details:

Stachelhaus sequence:: DVrHMSmVeK
Nearest Stachelhaus code:: ser
Stachelhaus code match:: 70% (weak)

c00088_NODE_88.. - Region 1 - NRPS-like,T1PKS

Download region GenBank file

Download region SVG

Location: 1 - 17,008 nt. (total: 17,008 nt) Show pHMM detection rules used

Region on contig edge.

T1PKS: cds(PKS_AT and (PKS_KS or ene_KS or mod_KS or hyb_KS or itr_KS or tra_KS))
NRPS-like: cds((PP-binding or NAD_binding_4) and (AMP-binding or A-OX))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

NRPS/PKS domains

KnownClusterBlast

NRPS/PKS modules

Detailed domain annotation

Selected features only

Show module domains

Similar known gene clusters

No matches found.

Module view

Legend

NRPS/PKS products

NRPS/PKS monomers

Predicted core structure(s)

For candidate cluster 1, location 0 - 17008:

Rough prediction of core scaffold based on assumed PKS/NRPS colinearity; tailoring reactions not taken into account

Polymer prediction:: (X) + (ohmal)

Direct lookup in NORINE database: strict or relaxed

Link to NORINE database query form

NRPS/PKS monomer predictions

ctg88_7

PKS_AT (511..788): mal

ATSignature: Malonyl-CoA

Top 3 matches:: Malonyl-CoA: 54.2%

minowa: Malonyl-CoA

Prediction, score:

Malonyl-CoA: 31.1
Methoxymalonyl-CoA: 17.2
Propionyl-CoA: 15.4
Methylmalonyl-CoA: 12.6
Ethylmalonyl-CoA: 12.0
2-Methylbutyryl-CoA: 10.3
inactive: 9.5
trans-1,2-CPDA: 0.0
fatty_acid: 0.0
Isobutyryl-CoA: 0.0
CHC-CoA: 0.0
Benzoyl-CoA: 0.0
Acetyl-CoA: 0.0
3-Methylbutyryl-CoA: 0.0

ctg88_8

Search NORINE for peptide: strict or relaxed

AMP-binding (30..391): X

NRPSPredictor2: (unknown)

SVM prediction details:

NOTE: outside applicability domain

Predicted physicochemical class:: hydrophobic-aliphatic
Large clusters prediction:: N/A
Small clusters prediction:: N/A
Single AA prediction:: N/A

Stachelhaus prediction details:

Stachelhaus sequence:: gyccLsTgqK
Nearest Stachelhaus code:: ala
Stachelhaus code match:: 30% (weak)

c00102_NODE_10.. - Region 1 - lanthipeptide-class-i

Download region GenBank file

Download region SVG

Location: 1 - 9,777 nt. (total: 9,777 nt) Show pHMM detection rules used

Region on contig edge.

lanthipeptide-class-i: ((LANC_like and (Lant_dehydr_N or Lant_dehydr_C)) and not (YcaO or TIGR03882))

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Lanthipeptides

Similar known gene clusters

No matches found.

Lanthipeptide predictions

Lanthipeptide(s) for ctg102_5 - Putative Class I

ctg102_6 leader / core peptide: MTRSTVVPSRTEVRPQLPGASDGFDLDVSLVEIADPA - GLVNLDhbDDNCGDhaDhbCGACDhbDhbNVA

Legend:

Dha: Didehydroalanine
Dhb: Didehydrobutyrine

Lanthipeptides

Core peptide predictions

ctg102_6 - Class I

Cleavage pHMM score: 0.70

RODEO score: 19

Monoisotopic mass: 2037.9 Da

Molecular weight: 2039.2 Da

Number of bridges: 3

Alternative weights: (assuming N unmodified Ser/Thr residues); 2057.2 Da N = 1; 2075.2 Da N = 2

c00131_NODE_13.. - Region 1 - siderophore

Download region GenBank file

Download region SVG

Location: 1 - 2,135 nt. (total: 2,135 nt) Show pHMM detection rules used

Region on contig edge.

siderophore: IucA_IucC

Legend:

core biosynthetic genes

additional biosynthetic genes

transport-related genes

regulatory genes

other genes

resistance

TTA codons

reset view

zoom to selection

Gene details

Select a gene to view the details available for it

KnownClusterBlast

Similar known gene clusters